Napoleon P500RSIBPSS-3 Prestige 500 RSIB Propane Gas Grill, sq. in + Infrared Side and Rear Burner, Stainless Steel
$1499.00
Features
4 Stainless Steel main burners that produce 48,000 BTU-per-hour input along with Stainless Steel sear plates that provide even heat with their layered positioning and intense flavor for creating Unforgettable meals
Invite all your friends and family over with 500 square inches of main cooking space, enough to cook 31 burgers at once!
Take advantage of the extra 260 Square inches of cooking space offered by the warming rack and 140 square inches on your side burner
Forget the matches, a quick start up you can count on every time with the flame throwing JETFIRE ignition system on each main burner. As an added back up feature the Napoleon prestige 500 offers a back channel between burners to allow them to light off each other. Never worry about your grill not lighting Ever again You will be up and grilling The first time every time
Cook a steak house quality steak every time with the infrared sizzle Zone side burner that heats up to 1800 degrees in 30 seconds
Enjoy rotisserie cooked food with the 18,000 BTU Infrared rear burner and the Napoleon heavy duty rotisserie kit included with purchase. Why not get a bit creative with the Napoleon rotisserie basket perfect for rotisserie vegetables, fried or Chick wings (accessory sold separately).
Details
rsfrmyurudrkgexpereewhhepeP500RSBPSS-3Presge500RSBPrpeGsGr.Wh4SessSeemburersprdug48,000BU-per-hurpudSessSeeserpesfrevehedsrbu,hsgresuresufrgebemeswhesefvrs.mpressyurguesswhs500squrehesfmkgspe,perfefrgrgup31burgerse!
Expereehsse-freegrgwhheJEFREgsysemhprmsesqukdrebesr-ups.Sygdbyemugmehdsdejyheveeefmmedehegehmburer.Whddwrmgrkdsdeburer,yuhvef400squrehesfexrkgspe,ergyururyeeds.
Frsekehusss,hefrredSzzeZesdeburerhesupbzg1800degrees30seds,esurgresur-quysekseveryme.Deghrssere-kedfdswhheuded18,000BUfrredrerburerdhevy-duyrsserek.Eeveyurgrgexpereefurherwhheppersserebskefrversekgps.
D'mssuregdeusmesdufrgebemmeswhhepeP500RSBPSS-3.Upgrdeyurgrggmedmkememreswhfredsdfmyhwsfeme!Grbyursdy!
Discover More Best Sellers in Top Products: Best Sellers
Shop Top Products: Best Sellers
Merriam-Webster's Everyday Language Reference Set
Top Products: Best Sellers - Merriam-Webster's Everyday Language Reference Set
Top Products: Best Sellers - Dual 2 Zone 9000 12000 Ductless Mini Split Ceiling Cassette Air Conditioner Heat Pump Multi Sophia Series
Top Products: Best Sellers - Mellanni Queen Sheets Set - 4 PC Iconic Collection Bedding - Hotel Luxury, Extra Soft, Cooling Bed Sheets - Wrinkle, Fade, Stain Resistant (Queen, Blush Pink)
ARIEL Bayhill 55 in. Rectangle Sink Vanity with 1.5" Inch White Quartz Countertop in Grey
Top Products: Best Sellers - ARIEL Bayhill 55 in. Rectangle Sink Vanity with 1.5" Inch White Quartz Countertop in Grey
Top Products: Best Sellers - MaXpeedingrods 5500W Inverter Generator,Gas Powered, 86lbs, Electric Start, EPA Compliant, for Mobile Home Yard Garage Woodwork,Wheel & Handle Kit,RV Ready
Top Products: Best Sellers - LTCCDSS Ceramic Infrared Sauna 1 Person Far Infrared Sauna Hemlock Saunas Room for Home Indoor Sauna with Low EMF Heaters Ceramic Heating Cubes Chromotherapy Bluetooth Speaker
Top Products: Best Sellers - Mini Mic Pro (Latest Model) - Wireless Mini Microphone for iPhone, iPad, Android - 2 Pack Lavalier Microphone for Video Recording - iPhone Mic Crystal Clear Recording with USB-C for Content Creators
Top Products: Best Sellers - HobbyToki 1/16 Hand-Made Ukraine BTR-4 Infantry Fight Vehicle IFV RTR Ready to Go Bucephalus Armoured Transporter Military Army with Metal Chassis and Shell (Master Camouflage)$1,227.00
Top Products: Best Sellers - Pure Protein Galactic Brownie Protein Bars – 20g Protein, 3g Sugar, 190 Calories (12 count) Low Sugar* High Protein Snack - Gluten Free - Perfect for a Healthy Snack

